Good stuff
Good stuff, great price, fast delivery.
Long-acting IGF-1 analogue
36% offer included · multi-buy savings shown below
Totals include multi-buy savings; per-vial prices are rounded. Your selected quantity is shown in the cart.




Get notified when back in stock
For Research Use Only — Not for Human Consumption
Insulin-like Growth Factor-1 Long Arg3 (IGF-1 LR3) is a synthetic analogue of IGF-1 featuring an arginine substitution at position 3 and a 13-amino-acid N-terminal extension. These modifications significantly reduce IGF-1 LR3's binding to IGF binding proteins while maintaining high affinity for the IGF-1 receptor, making it a powerful research tool for studying cell proliferation, differentiation, and survival signalling pathways. Research applications span muscle cell biology, tissue regeneration models, and investigations into the IGF-1/PI3K/Akt/mTOR signalling cascade. The LR3 modification provides enhanced biological activity and extended half-life in research models compared to native IGF-1. AllMyPeptides supplies IGF-1 LR3 as a lyophilised research peptide with independent HPLC purity verification of 99%+ by independent third-party laboratories. Supplied strictly for in-vitro laboratory research use only, and not for human or veterinary consumption or any clinical, diagnostic, or therapeutic use.
CAS Number
946870-92-4
Molecular Formula
C400H625N111O115S9
Molecular Weight
9117.5 g/mol
Appearance
White lyophilised powder
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
A selection of customer feedback, not the complete review history. These are reviews of the business, not product-specific ratings.
Read the full Trustpilot profile ↗Good stuff, great price, fast delivery.
Great service definitely using again
The Customer Service I received from Allmypeptides was Outstanding from the Start to finish . The emails I received were very prompt and helpful . The agent Genuinely cared and the entire process was smooth and stress free . If I could give more than 5 stars to Allmypeptides I would as it's rare to find a company that maintains such high standards of care the whole way through . I Will Definitely be Recommending them . Paul
The Customer Service I received from Allmypeptides was Outstanding from the Start to finish . The emails … (excerpt)
Amazing site, top quality products and fast safe delivery. 100% recommend
Excellent customer service and exceptional quality will order again and again. 100% recommend
Excellent company, competitive prices and swift service.
Great company. Everything you need. Quick and discreet dispatch. Great prices and good comments. Recommended. A+++
Top service , next day received at good prices
The order process felt organized from beginning to end. Nothing confusing or frustrating — very professional.
This website is great — the products are by far the best I've found so far. Extremely fast delivery and fantastic customer support. Recommended.
This website is great — the products are by far the best I've found so far. Extremely fast delivery and f… (excerpt)
Mega fast delivery. Also customer service was bang on. One simple issue and sorted right away. Highly recommend
Easy to follow website page. Easy to order. Very good calculations to find out correct mixing procedure. Excellent communication when I had a issue. Delivery is super fast.
Easy to follow website page. Easy to order. Very good calculations to find out correct mixing procedure. … (excerpt)
The platform has been reliable from day one, fast loading times and responsive support.
Easy to order, very well packaged, and swift delivery. Thank you!
Fantastic products! Speedy delivery. Superb customer services!!
First minutes i was a bit disoriented, now it feels like home.
Great correspondence! Great service and prices.
Great prices, items arrived very quickly and in great condition. I had a small issue which was my fault but customer support sorted it asap.
Great prices, items arrived very quickly and in great condition. I had a small issue which was my fault b… (excerpt)
Super fast delivery, responsive customer service and came packaged well. Seems to be good quality products as well, so I hope to be a regular.
Super fast delivery, responsive customer service and came packaged well. Seems to be good quality product… (excerpt)
| Customer | Review | Rating | Experience date | Verification |
|---|---|---|---|---|
| Customer | Good stuff Good stuff, great price, fast delivery. | 5 / 5 | Marked verified on Trustpilot | |
| Sat Sohal | Great service definitely using again Great service definitely using again | 5 / 5 | Marked verified on Trustpilot | |
| bobnboo | Exceptional Customer service from Start to Finish The Customer Service I received from Allmypeptides was Outstanding from the Start to finish . The emails I received were very prompt and helpful . The agent Genuinely cared and the entire process was smooth and stress free . If I could give more than 5 stars to Allmypeptides I would as it's rare to find a company that maintains such high standards of care the whole way through . I Will Definitely be Recommending them . Paul | 5 / 5 | Not supplied | Label not supplied |
| Stephen Suttle-Burton | Amazing site Amazing site, top quality products and fast safe delivery. 100% recommend | 5 / 5 | Marked verified on Trustpilot | |
| Wayne | Excellent customer service and... Excellent customer service and exceptional quality will order again and again. 100% recommend | 5 / 5 | Marked verified on Trustpilot | |
| Mr Chris Thomas | Excellent company Excellent company, competitive prices and swift service. | 5 / 5 | Marked verified on Trustpilot | |
| james allum | Great company Great company. Everything you need. Quick and discreet dispatch. Great prices and good comments. Recommended. A+++ | 5 / 5 | Marked verified on Trustpilot | |
| Nicholas Foster | Top service Top service , next day received at good prices | 5 / 5 | Label not supplied | |
| Name not supplied | The order process felt organized from beginning to end. Nothing confusing or frustrating — very professional. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | This website is great — the products are by far the best I've found so far. Extremely fast delivery and fantastic customer support. Recommended. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Mega fast delivery. Also customer service was bang on. One simple issue and sorted right away. Highly recommend | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Easy to follow website page. Easy to order. Very good calculations to find out correct mixing procedure. Excellent communication when I had a issue. Delivery is super fast. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | The platform has been reliable from day one, fast loading times and responsive support. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Easy to order, very well packaged, and swift delivery. Thank you! | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Fantastic products! Speedy delivery. Superb customer services!! | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | First minutes i was a bit disoriented, now it feels like home. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Great correspondence! Great service and prices. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Great prices, items arrived very quickly and in great condition. I had a small issue which was my fault but customer support sorted it asap. | 5 / 5 | Not supplied | Label not supplied |
| Name not supplied | Super fast delivery, responsive customer service and came packaged well. Seems to be good quality products as well, so I hope to be a regular. | 5 / 5 | Not supplied | Label not supplied |
19 selected reviews · scroll to read
Use our free Peptide Calculator and step-by-step Reconstitution Guide
Our UK-based support team is available Mon-Fri, 9am-5pm. Fast response within 24 hours.