Skip to main content
Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|Free UK Shipping on all £75+ orders|Next-Day Delivery, Order Before 2pm|Join AMP Rewards — Earn Points on Every Order|100 Bonus Points When You Sign Up|99%+ HPLC Verified — COA With Every Batch|
Home>Shop>IGF-1 LR3

IGF-1 LR3 1mg

IGF-1 LR3 1mg research peptide vial for cell growth and protein synthesis studies

Product illustration. Check the selected size and product details.

COA Verified
99%+ Purity
HPLC Verified
UK Shipping
Secure Payment
Read our IGF-1 LR3 research guide

Product Highlights

  • Independently tested by independent third-party laboratories
  • Certificate of Analysis included with every order
  • Protective tracked packaging with tracked delivery
  • Next-day delivery on orders before 2pm
99%+ Purity COA Included Secure Checkout Easy Returns
Growth Hormone Secretagogues Peptide

IGF-1 LR3

Long-acting IGF-1 analogue

1
£40.49£63.2736% OFF

36% offer included · multi-buy savings shown below

Make it a multi-buy.

Same item. Clear savings.

Totals include multi-buy savings; per-vial prices are rounded. Your selected quantity is shown in the cart.

We acceptVisaMastercardApple PayGoogle Pay

Get notified when back in stock

For Research Use Only — Not for Human Consumption

UK Shipping
Express (Next Day)£3.99 (Free £75+)
Dispatch TimeBefore 2pm
CoverageEntire UK
Research dataPubChem·PubMed
Full shipping details

Insulin-like Growth Factor-1 Long Arg3 (IGF-1 LR3) is a synthetic analogue of IGF-1 featuring an arginine substitution at position 3 and a 13-amino-acid N-terminal extension. These modifications significantly reduce IGF-1 LR3's binding to IGF binding proteins while maintaining high affinity for the IGF-1 receptor, making it a powerful research tool for studying cell proliferation, differentiation, and survival signalling pathways. Research applications span muscle cell biology, tissue regeneration models, and investigations into the IGF-1/PI3K/Akt/mTOR signalling cascade. The LR3 modification provides enhanced biological activity and extended half-life in research models compared to native IGF-1. AllMyPeptides supplies IGF-1 LR3 as a lyophilised research peptide with independent HPLC purity verification of 99%+ by independent third-party laboratories. Supplied strictly for in-vitro laboratory research use only, and not for human or veterinary consumption or any clinical, diagnostic, or therapeutic use.

CAS Number

946870-92-4

Molecular Formula

C400H625N111O115S9

Molecular Weight

9117.5 g/mol

Appearance

White lyophilised powder

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Selected customer reviews

A selection of customer feedback, not the complete review history. These are reviews of the business, not product-specific ratings.

Read the full Trustpilot profile ↗
Read customer feedback

Good stuff

Good stuff, great price, fast delivery.
Customer
Experience:
Marked verified on Trustpilot

Great service definitely using again

Great service definitely using again
Sat Sohal
Experience:
Marked verified on Trustpilot

Exceptional Customer service from Start to Finish

Read the full review
The Customer Service I received from Allmypeptides was Outstanding from the Start to finish . The emails I received were very prompt and helpful . The agent Genuinely cared and the entire process was smooth and stress free . If I could give more than 5 stars to Allmypeptides I would as it's rare to find a company that maintains such high standards of care the whole way through . I Will Definitely be Recommending them . Paul
The Customer Service I received from Allmypeptides was Outstanding from the Start to finish . The emails … (excerpt)
bobnboo
Verification label not supplied

Amazing site

Amazing site, top quality products and fast safe delivery. 100% recommend
Stephen Suttle-Burton
Experience:
Marked verified on Trustpilot

Excellent customer service and...

Excellent customer service and exceptional quality will order again and again. 100% recommend
Wayne
Experience:
Marked verified on Trustpilot

Excellent company

Excellent company, competitive prices and swift service.
Mr Chris Thomas
Experience:
Marked verified on Trustpilot

Great company

Great company. Everything you need. Quick and discreet dispatch. Great prices and good comments. Recommended. A+++
james allum
Experience:
Marked verified on Trustpilot

Top service

Top service , next day received at good prices
Nicholas Foster
Experience:
Verification label not supplied
The order process felt organized from beginning to end. Nothing confusing or frustrating — very professional.
Reviewer name not supplied
Verification label not supplied
Read the full review
This website is great — the products are by far the best I've found so far. Extremely fast delivery and fantastic customer support. Recommended.
This website is great — the products are by far the best I've found so far. Extremely fast delivery and f… (excerpt)
Reviewer name not supplied
Verification label not supplied
Mega fast delivery. Also customer service was bang on. One simple issue and sorted right away. Highly recommend
Reviewer name not supplied
Verification label not supplied
Read the full review
Easy to follow website page. Easy to order. Very good calculations to find out correct mixing procedure. Excellent communication when I had a issue. Delivery is super fast.
Easy to follow website page. Easy to order. Very good calculations to find out correct mixing procedure. … (excerpt)
Reviewer name not supplied
Verification label not supplied
The platform has been reliable from day one, fast loading times and responsive support.
Reviewer name not supplied
Verification label not supplied
Easy to order, very well packaged, and swift delivery. Thank you!
Reviewer name not supplied
Verification label not supplied
Fantastic products! Speedy delivery. Superb customer services!!
Reviewer name not supplied
Verification label not supplied
First minutes i was a bit disoriented, now it feels like home.
Reviewer name not supplied
Verification label not supplied
Great correspondence! Great service and prices.
Reviewer name not supplied
Verification label not supplied
Read the full review
Great prices, items arrived very quickly and in great condition. I had a small issue which was my fault but customer support sorted it asap.
Great prices, items arrived very quickly and in great condition. I had a small issue which was my fault b… (excerpt)
Reviewer name not supplied
Verification label not supplied
Read the full review
Super fast delivery, responsive customer service and came packaged well. Seems to be good quality products as well, so I hope to be a regular.
Super fast delivery, responsive customer service and came packaged well. Seems to be good quality product… (excerpt)
Reviewer name not supplied
Verification label not supplied

19 selected reviews · scroll to read

Need Help With Reconstitution?

Use our free Peptide Calculator and step-by-step Reconstitution Guide

Need Help?

Our UK-based support team is available Mon-Fri, 9am-5pm. Fast response within 24 hours.

Frequently Asked Questions

What is the purity of your IGF-1 LR3?+
Our IGF-1 LR3 is 99%+ pure, verified by independent third-party HPLC and mass spectrometry analysis. A Certificate of Analysis (COA) is included with every order.
How should I store IGF-1 LR3?+
IGF-1 LR3 should be stored in a cool, dry place away from direct light. For long-term storage, refrigeration at 2-8°C is recommended. Always reconstitute with bacteriostatic water and use proper aseptic technique.
How do I reconstitute IGF-1 LR3?+
Use our free Peptide Calculator to determine the correct amount of bacteriostatic water for your desired concentration. Slowly inject the water down the side of the vial — do not spray directly onto the peptide. Gently swirl until fully dissolved.
Is IGF-1 LR3 for human consumption?+
No. All products sold by AllMyPeptides are strictly for in vitro research and laboratory use only. They are not intended for human consumption, diagnostic, or therapeutic purposes. Purchasers must be qualified researchers aged 18 or over.
How quickly will my order arrive?+
Order before 2pm Monday to Friday and we dispatch the same day on Royal Mail Tracked Express — almost always with you the next working day. Free on orders over £75. We ship across the entire UK.